arrowawardbinbottlebottlescartcheckcheck_green_xleditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning asian bargain beef cheese dessert fish lamb pork poultry tip top-10 vegetarian venison

Produktbild von Riesling Sekt Extra trocken

« Zurück

Abbildung beispielhaft

Riesling Sekt Extra trocken Winzersekte Deutschland & Österreich

  • Sekt/Qualitätsschaumwein

Beschreibung

Riesling-Sekt aus der nördlichen Pfalz mit reintönigem Bukett und Aromen von hellen Steinfrüchten, am Gaumen frisch und spritzig mit anhaltendem Mousseux.

Produktinformationen

Geschmack extra trocken / extra dry / extra sec
Rebsorte(n) Riesling
Flaschengröße 0,75 l
Verschluss Korken
Qualitätsstufe Winzersekt
Herkunft Pfalz (Deutschland)
Alkoholgehalt 12,5% vol
Empfohlene Trinktemperatur von 9,0 bis 11,0 °C
Enthält Sulfite Ja
Enthält Ei-Allergene Enthält Protein
Enthält Milch-Allergene Enthält Milchprotein
Gärung Edelstahltank

Winzersekte Deutschland & Österreich

Trotz der mittlerweile stattlichen 30 ha Rebfläche ist das Weingut aus der nördlichen Pfalz ein klassischer Familienbetrieb. Die große Beliebtheit der Langenwalter-Gewächse liegt zum einen am schwer zu schlagenden Preis-Genuss-Verhältnis, zum anderen (wenn man mal von den „Schönen trockenen Cuvées“ absieht) an blitzsauberen, perfekt ausbalancierten und harmonischen Rebsortenweinen, die uns zu einem liebgewonnenen Wegbegleiter geworden sind.

9,95€ 13,27€/Liter
inkl. Mwst. (zzgl. Versandkosten)

Produkte werden in 3 – 5 Werktagen geliefert.

Schmeckt zu

  • Fisch & Meeresfrüchte
  • Vegetarisch

Produzent

  • Winzersekte Deutschland & Österreich

  • Deutschland / Pfalz

  • Bahnhofstraße 45, 67256 Weisenheim

Informationen zum Shop von Weinladen Schmidt

Log in