arrowawardbinbottlebottlescartcheckcheck_green_xleditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning asian bargain beef cheese dessert fish lamb pork poultry tip top-10 vegetarian venison

Produktbild von Sauvignon Blanc, WLS-Exklusiv, trocken

« Zurück

Abbildung beispielhaft

  • Spargel- & Frühlingsweine

Sauvignon Blanc, WLS-Exklusiv, trocken 2018 Weingut Aldinger

  • Wein


Heiligs Blechle, was für ein schöner Sauvignon! Keine laute Aromatik, stattdessen eine kühle, komplexe Stilistik mit subtiler Kräuterwürze und beeindruckender Harmonie. Der Wein der Aldingers kommt mit einer berührenden Behutsamkeit daher. Er ist mitteilsam, aber nicht geschwätzig. Der Sauvignon Blanc hat im Ländle schon eine jahrhundertealte Tradition und war lange unter der Synonym Muscat-Sylvaner bekannt.


Geschmack trocken
Jahrgang 2018
Rebsorte(n) Sauvignon Blanc
Flaschengröße 0,75 l
Verschluss Schraubverschluss
Qualitätsstufe Deutscher Qualitätswein
Herkunft Württemberg (Deutschland)
Alkoholgehalt 12,5% vol
Empfohlene Trinktemperatur von 8,0 bis 10,0 °C
Enthält Sulfite Ja
Enthält Ei-Allergene Enthält Protein
Enthält Milch-Allergene Enthält Milchprotein
Gärung Edelstahltank

Weingut Aldinger

Die überaus sympathische und sozial engagierte Familie Aldinger kann mit einigem Stolz auf eine über 500-jährige Weinbautradition zurückblicken. Heute gehört sie unbestritten zu den Württemberger Aushängeschildern. Ihre auf buntem Mergel, Stubensandstein und dem seltenen Gipskeuper gewachsenen Weine brillieren mit einer wundervollen Melange aus Präzision, Tiefgründigkeit und Harmonie.

12,95€ 17,27€/Liter
inkl. Mwst. (zzgl. Versandkosten)

Produkte werden in 3 – 5 Werktagen geliefert.

Schmeckt zu

  • Fisch & Meeresfrüchte
  • Vegetarisch
  • Asiatisch

Zertifikate und Mitgliedschaften


  • Weingut Aldinger

  • Deutschland / Württemberg

  • Schmerstraße 25, 70734 Fellbach

Informationen zum Shop von Weinladen Schmidt

Log in