arrowawardbinbottlebottlescartcheckcheck_green_xleditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning asian bargain beef cheese dessert seafood lamb pork poultry tip top-10 vegetarian venison

Produktbild von Señorio de P. Peciña, Rosado Cosecha

« Zurück

Abbildung beispielhaft

Señorio de P. Peciña, Rosado Cosecha 2018 Bodegas Hermanos Peciña

  • Wein


Der Rosado mag für die Gebrüder (Hermanos) Peciña aus der Rioja Alta eher ein Beifang ihrer famosen Rotweine sein. Die Qualität und Stilistik des zu 100% aus Garnacha gekelterten Rosés zeugt allemal von den hohen Qualitätsansprüchen des Hauses. Die händisch gelesenen Trauben stammen aus dem 600 m hoch gelegenen Weinberg „La Tejera“ und bringen ausgesprochen frisches, reintöniges Material in den Keller. Perfekt zu Paella und Grillgerichten.


Geschmack trocken
Jahrgang 2018
Rebsorte(n) Garnacha
Flaschengröße 0,75 l
Verschluss Korken
Qualitätsstufe D.O.C.
Herkunft La Rioja (Spanien)
Alkoholgehalt 12,5% vol
Empfohlene Trinktemperatur von 14,0 bis 16,0 °C
Enthält Sulfite Ja
Enthält Ei-Allergene Enthält Protein
Enthält Milch-Allergene Enthält Milchprotein
Gärung Edelstahltank
Ausbau Edelstahltank

Bodegas Hermanos Peciña

Mit ihren 25 Jahren und 50 ha Weinbergen gehören die Bodegas der Gebrüder (Hermanos) Peciña zu den eher jungen und kleinen Weingütern im Lande. Die auf den steinigen, zuweilen kalkreichen Böden der Rioja Alta wurzelnden Reben sind allerdings meist doppelt so alt wie das Weingut. Pedro, der vorher 20 Jahre als Agronom in der Region tätig war, lässt seine Weine deutlich länger als weingesetzlich vorgeschrieben in Fässern und Flaschen reifen. Er verschreibt sich bei der Cuvéetierung und im Ausbau ganz dem traditionellen Stil: Mit einem sehr hohen Tempranillo-Anteil, mit hohem Reifepotenzial und dem Verzicht auf neue Barriques. Die Peciña-Rioja bieten eher frischen Trinkfluss statt vanilliger Beerenkonfitüre. „Old school“ ist modern!

10,50€ 14,00€/Liter
inkl. Mwst. (zzgl. Versandkosten)

Produkte werden in 3 – 5 Werktagen geliefert.

Schmeckt zu

  • Fisch und Meeresfrüchte
  • Käse


  • Bodegas Hermanos Peciña

  • Spanien / La Rioja

  • Ctra. Vitoria, km 47, 26338 San Vicente de la Sonsierra (La Rioja)

Informationen zum Shop von Weinladen Schmidt

Log in